All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (51)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (4)
- (12,287)
- (15,789)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (16)
- (108)
- (1)
- (189,950)
- (288,082)
- (1)
- (19)
- (798)
- (1)
- (12,208)
- (2)
- (126)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (12,965)
- (2)
- (4,299)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,034)
- (3,898)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,755)
- (18)
- (1)
- (1)
- (1)
- (5,542)
- (1)
- (2)
- (43)
- (4)
- (13)
- (1)
- (161)
- (747)
- (17)
- (2)
- (3)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,863)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (186)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (3)
- (23)
- (130)
- (8,919)
- (39,656)
- (448)
- (53)
- (1,929)
- (36)
- (7)
- (1)
- (2,676)
- (1)
- (4,471)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,159)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,469)
- (15)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,524)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,957)
- (24,931)
- (24,831)
- (24,989)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,904)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,471)
- (912)
- (835)
- (1,058)
- (1,061)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (4)
- (33,651)
- (5)
- (30)
- (1)
- (1)
- (338)
- (735)
- (30,824)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (57)
- (22)
- (54)
- (73)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (26)
- (60)
- (68)
- (42)
- (57)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (71)
- (454)
- (32,844)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (273)
- (250)
- (125)
- (126)
- (94)
- (46)
- (11)
- (6)
- (5)
- (8)
- (3)
- (5)
- (2)
- (56)
- (14)
- (542,383)
- (7)
- (266)
- (49)
- (2)
- (366)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (562)
- (2,884)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,665)
- (68)
- (123)
- (2,111)
- (31,144)
- (221)
- (8)
- (23)
- (597,642)
- (16)
- (1)
- (800,141)
- (84,180)
- (3)
- (45,147)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (5)
- (8,432)
- (7,040)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,277)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (676)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,591)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,361)
- (2,675)
- (43,521)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,330)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,142)
- (153,811)
- (191)
- (53)
- (197,210)
- (502,585)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,486)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,651)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,340)
- (4)
- (2)
- (3)
- (25)
- (6,535)
- (1)
- (6)
- (812)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,278)
- (39)
- (6)
- (43,435)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,391)
- (9)
- (2)
- (4)
- (136)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,776)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,576)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,774)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,097)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,896)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,697)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,301)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,889)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,222)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,481)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,995)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,297)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,443)
- (5)
- (4)
- (45)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,251)
- (532)
- (4)
- (10)
- (2)
- (338,638)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,776)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,570)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,928)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
NK1.1 Monoclonal Antibody (PK136), Brilliant Violet™ 480, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Mouse |
| Conjugate | Brilliant Violet 480 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2a κ |
| Gene Accession No. | P27812, P27814 |
| Concentration | 0.2 mg/mL |
| Antigen | NK1.1 |
| Gene Symbols | Klrb1b, Klrb1c |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AI462337; CD161; CD161 antigen-like family member B; CD161 antigen-like family member C; CD161b; CD161c; EMBL:AAQ11375.1}; Inhibitory receptor NKR-P1B; killer cell lectin-like receptor subfamily A member 1C; killer cell lectin-like receptor subfamily B member 1B; killer cell lectin-like receptor subfamily B member 1B allele A; Killer cell lectin-like receptor subfamily B member 1B allele B; killer cell lectin-like receptor subfamily B member 1B allele C; killer cell lectin-like receptor subfamily B member 1C; killer cell lectin-like receptor subfamily B member 1D; killer cell lectin-like receptor subfamily B member 1F; KLRB1; Klrb1b; klrb1b {ECO:0000312; Klrb1c; Klrb1d; Klrb1f; klrb1f {ECO:0000250; Ly55; Ly-55; Ly55b; ly-55b; Ly55c; ly-55c; Ly55d; Ly-55d; Ly59; Ly-59; lymphocyte antigen 55 complex, locus B; lymphocyte antigen 55 complex, locus C; lymphocyte antigen 55 complex, locus D; lymphocyte antigen 55b; lymphocyte antigen 55c; Lymphocyte antigen 55d; lymphocyte antigen 59; MGC163757; MGC163759; natural killer cell receptor protein NKR-P1B; natural killer cell receptor protein NKR-P1C; natural killer cell receptor-P1; natural killer cell surface protein NKR-P1B allele B6; Natural killer cell surface protein NKR-P1B allele RNK/SD/BN/F344; natural killer cell surface protein NKR-P1B allele SJL/BALB; natural killer cell surface protein NKR-P1B allele TO; natural killer cell surface protein NKR-P1F; Natural killer cell surface protein P1-40; natural killer cell-associated antigen 1; natural killer cells; nk cells; Nk1; Nk-1; NK1.1; Nk1.2; Nk-1.2; NKRP1; NK-RP1; NKR-P1 34; NKR-P1 40; NKR-P1.9; NKRP140; Nkrp1b; NKR-P1B; Nkrp1-b; NKR-P1B protein; Nkrp1c; NKR-P1C; Nkrp1d; NKR-P1D; Nkrp1f; NKR-P1F; RGD:2975}; UniProtKB:Q8VD98} |
| Product Type | Antibody |
| Gene ID (Entrez) | 17059, 80782 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | PK136 |
Invitrogen™ Ly-6G/Ly-6C Monoclonal Antibody (RB6-8C5)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Frozen),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P0CW02, P0CW03, P35461 |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | Ly-6G/Ly-6C |
| Gene Symbols | Ly6c1, Ly6c2, Ly6g |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | AA682074; AA959465; Gr1; Gr-1; Granulocyte Marker; Ly6c; Ly-6C; Ly-6C.2; Ly6c1; Ly-6C1; Ly6c2; Ly-6C2; Ly6g; Ly-6G; ly-6G.1; lymphocyte antigen 6 complex, locus C; lymphocyte antigen 6 complex, locus C1; lymphocyte antigen 6 complex, locus C2; lymphocyte antigen 6 complex, locus G; lymphocyte antigen 6C precursor (Ly-6C); lymphocyte antigen 6C1; Lymphocyte antigen 6C2; lymphocyte antigen 6G; Lymphocyte antigen Ly-6C; lymphocyte differentiation antigen; PML; PMN |
| Gene | Ly6c2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 100041546, 17067, 546644 |
| Formulation | PBS with 0.09% sodium azide; pH 7.4 |
| Immunogen | Normal murine bone marrow cells. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | RB6-8C5 |
Invitrogen™ CD15 Monoclonal Antibody (HI98), FITC, eBioscience™
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | FITC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P22083 |
| Isotype | IgM κ |
| Concentration | 5 μL/Test |
| Antigen | CD15 |
| Gene Symbols | FUT4 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | FUTIV; Lewis X; SSEA-1 |
| Gene | FUT4 |
| Product Type | Antibody |
| Gene ID (Entrez) | 2526 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HI98 |
Invitrogen™ EphA2 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P29317 |
| Isotype | IgG |
| Concentration | 0.25 mg/mL |
| Antigen | EphA2 |
| Gene Symbols | EPHA2 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | ARCC2; AW545284; CTPA; CTPP1; CTRCT6; Eck; EPH receptor A2; Epha2; ephrin receptor EphA2; Ephrin type-A receptor 2; Epithelial cell kinase; epithelial cell receptor protein tyrosine kinase; I79_019726; Myk2; Sek2; Sek-2; soluble EPHA2 variant 1; tyrosine-protein kinase receptor ECK; Tyrosine-protein kinase receptor MPK-5; tyrosine-protein kinase receptor SEK-2 |
| Gene | EPHA2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 1969 |
| Formulation | PBS with 0.1% sodium azide; pH 7.4 |
| Immunogen | Synthetic peptide derived from the C-terminal region of the human EphA2 receptor protein. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ TNF alpha Monoclonal Antibody (MAb11), Alexa Fluor™ 488, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 488 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P01375 |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | TNF alpha |
| Gene Symbols | Tnf |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | APC1 protein; Cachectin; C-domain 1; C-domain 2; cTNF; DADB-70P7.1; DIF; ICD1; ICD2; Intracellular domain 1; Intracellular domain 2; N-terminal fragment; NTF; RATTNF; Tnf; TNF alpha; TNF superfamily; TNF α; TNF, macrophage-derived; TNF, monocyte-derived; TNFA; TNF-a; TNFalpha; TNF-alpha; Tnfsf1a; TNFSF2; TNFα; TNLG1F; Tumor necrosis factor; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor alpha; tumor necrosis factor alpha (cachetin); tumor necrosis factor alpha precursor; tumor necrosis factor ligand 1F; tumor necrosis factor ligand superfamily member 2; Tumor necrosis factor, membrane form; Tumor necrosis factor, soluble form; tumor necrosis factor-alpha; tumor necrosis factor-alpha precursor; tumor-necrosis factor; tumour necrosis factor |
| Gene | Tnf |
| Product Type | Antibody |
| Gene ID (Entrez) | 7124 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MAb11 |
CD163 Monoclonal Antibody (TNKUPJ), eBioscience™, Invitrogen™
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, do not freeze |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen) |
| Form | Liquid |
| Isotype | IgG2a κ |
| Gene Accession No. | Q2VLH6 |
| Concentration | 0.5 mg/mL |
| Antigen | CD163 |
| Gene Symbols | CD163 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD163; CD163 antigen; CD163 molecule; CD163v2; CD163v3; Hemoglobin scavenger receptor; M130; macrophage-associated antigen; MM130; putative CD163 antigen; SCARI1; Scavenger receptor cysteine-rich type 1 protein M130; sCD163; Soluble CD163; Soluble sCD163 |
| Gene | CD163 |
| Product Type | Antibody |
| Gene ID (Entrez) | 93671 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | TNKUPJ |
Invitrogen™ CD133 (Prominin-1) Monoclonal Antibody (TMP4), PE, eBioscience™
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | PE |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | O43490 |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | CD133 (Prominin-1) |
| Gene Symbols | PROM1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 4932416E19Rik; AC133; Antigen AC133; antigen AC133 homolog; antigen CD133; CD107b; CD133; CORD12; fudenine; hematopoietic stem cell antigen; hProminin; Lamp II; Lamp2; LAMP-2; Lamp-2a; Lamp-2b; Lamp-2c; LGP-96; LGP-B; Mac3; MCDR2; MSTP061; Prom; PROM1; Prom-1; prominin 1; prominin 1.s1; Prominin1; prominin-1; prominin-1.s2; prominin-like 1; prominin-like protein 1; PROML1; RP41; STGD4 |
| Gene | PROM1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 8842 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | TMP4 |
Invitrogen™ HTR2A Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P14842, P28223 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | HTR2A |
| Gene Symbols | Htr2a |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 5-HT-2; 5Ht-2; 5-HT2 receptor; 5-HT2A; 5-HT-2A; 5HT2A Receptor; 5-HT2A receptor; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine (serotonin) receptor 2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine 2 receptor; 5-hydroxytryptamine receptor 2A; E030013E04; Htr2; Htr-2; HTR2A; serotonin 5HT-2 receptor; serotonin 5-HT-2A receptor; serotonin receptor 2A; SR2A |
| Gene | Htr2a |
| Product Type | Antibody |
| Gene ID (Entrez) | 29595, 3356 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) . |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CD20 Monoclonal Antibody (HI47), PE
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | PE |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P11836 |
| Isotype | IgG3 |
| Antigen | CD20 |
| Gene Symbols | Ms4a1 |
| Regulatory Status | ASR |
| Purification Method | Purified |
| Gene Alias | AA960661; APY; ATOPY; B1; B-cell differentiation antigen Ly-44; B-lymphocyte antigen CD20; B-lymphocyte cell-surface antigen B1; B-lymphocyte surface antigen B1; Bp35; Cd20; CD20 antigen; CD20 cell surface protein; CD20 receptor; CVID5; EGK_06167; Fc epsilon receptor I beta chain; Fc Fragment of IgE high affinity I receptor for beta polypeptide; FCER1B; High affinity immunoglobulin epsilon receptor subunit beta; IgE Fc receptor subunit beta; IGEL; IGER; IGHER; LEU16; LEU-16; Leukocyte surface antigen Leu-16; Ly44; Ly-44; Lymphocyte antigen 44; membrane spanning 4-domains A1; membrane-spanning 4-domains subfamily A member 1; membrane-spanning 4-domains, subfamily A, member 1; membrane-spanning 4-domains, subfamily A, member 2; MGC3969; MS4A1; MS4A2; S7 |
| Gene | Ms4a1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 931 |
| Formulation | PBS with 4mg/mL BSA, sucrose and 0.1% sodium azide |
| Immunogen | CD20 antigen. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HI47 |
Invitrogen™ CD298 Monoclonal Antibody (M016)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P54709 |
| Isotype | IgG1 |
| Concentration | 0.5 mg/mL |
| Antigen | CD298 |
| Gene Symbols | ATP1B3 |
| Regulatory Status | RUO |
| Purification Method | Protein G |
| Gene Alias | AA409958; AI664000; Atp1b3; ATPase Na+/K+ transporting subunit beta 3; ATPase, Na+/K+ beta 3 polypeptide; ATPase, Na+/K+ transporting, beta 3 polypeptide; ATPase, Na+K+ transporting, beta polypeptide 3; ATPB-3; AW212096; CD298; CD298 antigen; Na K-ATPase beta-3 subunit; Na+/K+ -ATPase beta 3 subunit; NKAB3S; Sodium Potassium ATPase; Sodium/potassium-dependent ATPase subunit beta-3; sodium/potassium-transporting ATPase subunit beta-3 |
| Gene | ATP1B3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 483 |
| Formulation | PBS with 1mg/mL BSA, 50% glycerol and 0.05% sodium azide |
| Immunogen | Clone (M016) was generated from a proprietary antigen related to the native human Na+/K+ ATPase beta3 subunit expressed in A431 epidermoid carcinoma cell line. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | M016 |
Invitrogen™ CD42b Monoclonal Antibody (MB45), FITC
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | FITC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P07359 |
| Isotype | IgG1 |
| Antigen | CD42b |
| Gene Symbols | Gp1ba |
| Regulatory Status | ASR |
| Purification Method | Purified |
| Gene Alias | Antigen CD42b-alpha; BDPLT1; BDPLT3; BSS; CD42a; CD42B; CD42b-alpha; DBPLT3; Glycocalicin; glycoprotein 1b, alpha polypeptide; glycoprotein Ib (platelet), alpha polypeptide; glycoprotein Ib platelet alpha subunit; glycoprotein Ib platelet subunit alpha; glycoprotein Ibalpha; GP1B; GP1BA; GPIB; GPIb alpha; GP-Ib alpha; GPIbA; GPIbalpha; GPIX; GP-IX; MGC34595; mutant platelet membrane glycoprotein Ib-alpha; platelet glycoprotein Ib alpha chain; platelet glycoprotein Ib alpha polypeptide; Platelet GPIX; platelet membrane glycoprotein 1b-alpha subunit; platelet membrane glycoprotein Ib-alpha; VWDP |
| Gene | Gp1ba |
| Product Type | Antibody |
| Gene ID (Entrez) | 2811 |
| Formulation | PBS with 4mg/mL BSA, 10% sucrose and 0.1% sodium azide |
| Immunogen | Human CD42b. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MB45 |
Invitrogen™ Tyrosine Hydroxylase Recombinant Rabbit Monoclonal Antibody (SN59-03)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P04177, P07101, P24529 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | Tyrosine Hydroxylase |
| Gene Symbols | TH |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | dystonia 14; DYT14; DYT5b; EC 1.14.16.2; HGNC:11782; Th; TH isoform 3; TH isoform a; th1; TH-4; The; TY3H; TYH; TYH antibody; Tyrosine 3-hydroxylase; tyrosine 3-monooxygenase; tyrosine hydroxylase |
| Gene | TH |
| Product Type | Antibody |
| Gene ID (Entrez) | 21823, 25085, 7054 |
| Formulation | TBS with 0.05% BSA, 40% glycerol and 0.05% sodium azide; pH 7.4 |
| Immunogen | Synthetic peptide within C-terminal human Tyrosine Hydroxylase. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SN59-03 |
Invitrogen™ Tyrosine Hydroxylase Recombinant Rabbit Monoclonal Antibody (SD080-02)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot |
| Form | Liquid |
| Gene Accession No. | P04177, P07101, P24529 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | Tyrosine Hydroxylase |
| Gene Symbols | TH |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | dystonia 14; DYT14; DYT5b; EC 1.14.16.2; HGNC:11782; Th; TH isoform 3; TH isoform a; th1; TH-4; The; TY3H; TYH; TYH antibody; Tyrosine 3-hydroxylase; tyrosine 3-monooxygenase; tyrosine hydroxylase |
| Gene | TH |
| Product Type | Antibody |
| Gene ID (Entrez) | 21823, 25085, 7054 |
| Formulation | TBS with 0.05% BSA, 40% glycerol and 0.05% sodium azide; pH 7.4 |
| Immunogen | Synthetic peptide within Human Tyrosine Hydroxylase aa 51-100/528. |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | SD080-02 |
Invitrogen™ iNOS Monoclonal Antibody (M398)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P29477, P35228, Q06518 |
| Isotype | IgG2a |
| Concentration | 0.25 mg/mL |
| Antigen | iNOS |
| Gene Symbols | Nos2 |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | Hepatocyte NOS; hepatocytes; HEP-NOS; inducible nitric oxide synthase; inducible NO synthase; Inducible NOS; iNos; i-NOS; Inosl; MAC-NOS; macrophage NOS; nitric oxide synthase 2; nitric oxide synthase 2, inducible; nitric oxide synthase 2, inducible, macrophage; nitric oxide synthase 2A (inducible, hepatocytes); nitric oxide synthase, inducible; nitric oxide synthase, macrophage; nitric oxide synthase-inducible; NOS; NOS type II; NOS, type II; Nos2; Nos-2; Nos2a; NOS-II; OTTMUSP00000000202; peptidyl-cysteine S-nitrosylase NOS2 |
| Gene | Nos2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 18126, 24599, 4843 |
| Formulation | PBS with 1mg/mL BSA, 50% glycerol and 0.05% sodium azide |
| Immunogen | Clone (M398) was generated from a recombinant protein that included amino acid residues within the C-terminal region of human iNOS. The human iNOS sequence used has high homology with similar regions in rat and mouse iNOS. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | M398 |
Invitrogen™ TCR V alpha 3.2 Monoclonal Antibody (RR3-16), Brilliant Violet™ 421, eBioscience™
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Brilliant Violet 421 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2b κ |
| Concentration | 0.2 mg/mL |
| Antigen | TCR V alpha 3.2 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | TCR V alpha3.2; TCRV alpha 3.2; TCRV alpha3.2; Va3.2; Valpha3.2 |
| Product Type | Antibody |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | RR3-16 |